PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g435550.1
Common NameMTR_3g435550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Nin-like
Protein Properties Length: 193aa    MW: 22483.8 Da    PI: 9.6279
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g435550.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.58.6e-2658106452
           RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++ e++s+yF++pi +AA+eL+v+lT LK++CR +GI+RWPhRk+ sl
  Medtr3g435550.1  58 MLTKETISEYFYMPISQAARELNVGLTHLKKRCRDLGIQRWPHRKLMSL 106
                      6899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.72342127IPR003035RWP-RK domain
PfamPF020428.9E-2259106IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MTDYGYGDAK NVVPMWNELD AGFYSDKHIF SISNIIGENV AKEIVKGKRC REENSARMLT  60
KETISEYFYM PISQAARELN VGLTHLKKRC RDLGIQRWPH RKLMSLQTLI KNVQEQGNEY  120
DEKIRNAVEV LQKEMKKVEE KPDLQLAENT KRLRQACFKA NYKKRRLMVM RLMDQSSISE  180
SSNVDDNHKM GY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459288.11e-143RWP-RK domain protein
SwissprotQ9M9U91e-51RKD1_ARATH; Protein RKD1
TrEMBLA0A072UU071e-143A0A072UU07_MEDTR; RWP-RK domain protein
STRINGGLYMA04G33516.11e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.17e-53RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]